PDB entry 5x8q

View 5x8q on RCSB PDB site
Description: Crystal Structure of the mutant Human ROR gamma Ligand Binding Domain With rockogenin.
Class: transferase/ihibitor
Keywords: Inhibitor, Ternary Complex, Nuclear Receptor, TRANSFERASE-IHIBITOR complex
Deposited on 2017-03-03, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d5x8qa_
  • Chain 'B':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d5x8qc_
  • Chain 'D':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d5x8qe_
  • Chain 'F':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (208)
      • engineered mutation (212)
    Domains in SCOPe 2.07: d5x8qg_
  • Chain 'H':
    Compound: Nuclear receptor corepressor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOR2, CTG26
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 82R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x8qA (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8qA (A:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x8qC (C:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8qC (C:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5x8qE (E:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8qE (E:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5x8qG (G:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8qG (G:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
    

  • Chain 'H':
    No sequence available.