PDB entry 5x8b

View 5x8b on RCSB PDB site
Description: Crystal structure of ATP-TMP and ADP bound thymidylate kinase from Thermus thermophilus HB8
Class: transferase
Keywords: Nucleotide monophosphate kinase, TRANSFERASE
Deposited on 2017-03-01, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x8ba_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x8bb_
  • Heterogens: ATP, TMP, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x8bA (A:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8bA (A:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaalleglgleffrrvregylalaraepgrfvvldatlpeeeiarai
    qahlrpllp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x8bB (B:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8bB (B:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaalrglgleffrrvregylalaraepgrfvvldatlpeeeiaraiq
    ahlrpll