PDB entry 5x7v

View 5x7v on RCSB PDB site
Description: Crystal structure of Nucleosome assembly protein S (PfNapS) from Plasmodium falciparum
Class: chaperone
Keywords: nucleosome assembly protein, histone recognition, chaperone
Deposited on 2017-02-27, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x7va_
  • Chain 'B':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x7vb_
  • Chain 'C':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x7vc_
  • Chain 'D':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x7vd_
  • Chain 'E':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x7ve_
  • Chain 'F':
    Compound: Nucleosome assembly protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: B7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5x7vf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x7vA (A:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7vA (A:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaapkwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x7vB (B:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7vB (B:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvikwkegkwsifewfttpdvgelirreiwhnplsyyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x7vC (C:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7vC (C:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavipkwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5x7vD (D:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7vD (D:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfvvec
    trikwkegknpiaavpkwsifewfttdelqdkpdvgelirreiwhnplsyyl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5x7vE (E:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7vE (E:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtekvve
    ctrikwkegknpiaavpkwsifewfttpdvgelirreiwhnplsyyl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5x7vF (F:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnnq
    ekvvectrikwkegknpiaavthnrsdldneipkwsifewfttdelqdkpdvgelirrei
    whnplsyylglee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7vF (F:)
    fmqdfediqkdieqldikcaheqmniqkqydekkkplfekrdeiiqkipgfwantlrkhp
    alsdivpedidilnhlvkldlkdnmdnngsykitfifgekakefmepltlvkhvtfdnek
    vvectrikwkegknpiaavpkwsifewfpdvgelirreiwhnplsyyl