PDB entry 5x7k

View 5x7k on RCSB PDB site
Description: Crystal structure of the nucleotide-binding domain (NBD) of LipB, a ABC transporter subunit of a type I secretion system
Class: transport protein
Keywords: ABC transporter, walker A, walker B, NBD, nucleotide binding domain, type I secretion system, T1SS, protein secretion, translocation system, TRANSPORT PROTEIN
Deposited on 2017-02-27, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipase b
    Species: Serratia marcescens [TaxId:615]
    Gene: lipB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7ka_
  • Chain 'B':
    Compound: lipase b
    Species: Serratia marcescens [TaxId:615]
    Gene: lipB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x7kA (A:)
    mslprpegvlsvegvtatppgskgdavlhnvsfaiqpgdvlgiigpsasgkstlarllvg
    iwpvsegivrldnadiyqwnkdelgpyigylpqdielfagtiaeniarfndidsekviea
    aklagvhelilrfpngydsvignggaglsggqkqriglaralygdpalvvldepnsnldd
    agekalnqaimflkqrnktvvlithrtnllsmtskllllvngnvnafgptqqvlqalana
    qkaqvppqavravnsepdegeipktqin
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7kA (A:)
    mslprpegvlsvegvtatppvlhnvsfaiqpgdvlgiigpsasgkstlarllvgiwpvse
    givrldnadiyqwnkdelgpyigylpqdielfagtiaeniarfndidsekvieaaklagv
    helilrfpngydsvignggaglsggqkqriglaralygdpalvvldepnsnlddagekal
    nqaimflkqrnktvvlithrtnllsmtskllllvngnvnafgptqqvlqalanaqka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x7kB (B:)
    mslprpegvlsvegvtatppgskgdavlhnvsfaiqpgdvlgiigpsasgkstlarllvg
    iwpvsegivrldnadiyqwnkdelgpyigylpqdielfagtiaeniarfndidsekviea
    aklagvhelilrfpngydsvignggaglsggqkqriglaralygdpalvvldepnsnldd
    agekalnqaimflkqrnktvvlithrtnllsmtskllllvngnvnafgptqqvlqalana
    qkaqvppqavravnsepdegeipktqin
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7kB (B:)
    mslprpegvlsvegvtatppgavlhnvsfaiqpgdvlgiigpsasgkstlarllvgiwpv
    segivrldnadiyigylpqdielfagtiaeniarfndidsekvieaaklagvhelilrfp
    ngydsvignggaglsggqkqriglaralygdpalvvldepnsnlddagekalnqaimflk
    qrnktvvlithrtnllsmtskllllvngnvnafgptqqvlqalanaq