PDB entry 5x7j

View 5x7j on RCSB PDB site
Description: Crystal structure of thymidylate kinase from thermus thermophilus HB8
Class: transferase
Keywords: NMP kinase, TRANSFERASE
Deposited on 2017-02-27, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7ja_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x7jb_
  • Heterogens: CL, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x7jA (A:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7jA (A:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrslqelspeaeyll
    fsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrglkp
    rltflldlppeaalrrvrlgleffrrvregylalaraepgrfvvldatlpeeeiaraiqa
    hlrpllp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x7jB (B:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x7jB (B:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatlp
    eeeiaraiqahlrpllp