PDB entry 5x5x

View 5x5x on RCSB PDB site
Description: Crystal structure of the Fab fragment of anti-osteocalcin C-terminal peptide antibody KTM219
Class: immune system
Keywords: Quenchbody (Q-body), Immunoglobulin fold, Osteocalcin, Open Sandwich Immunoassay (OS-IA), IMMUNE SYSTEM
Deposited on 2017-02-18, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fd chain of anti-osteocalcin antibody KTM219
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X5X
  • Chain 'L':
    Compound: L chain of anti-osteocalcin antibody KTM219
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X5X
    Domains in SCOPe 2.07: d5x5xl1, d5x5xl2
  • Heterogens: PEG, PG4, FMT, PGE, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5x5xL (L:)
    msdieltqsplslpvslgdqasisctssqsllhsngdtylhwylqkpgqspklliytlsn
    rfsgvpdrfsgsgsgtdftlkisrveaadlgiyfcsqtthvpytfgggtkleikradaap
    svfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdsty
    slsstltlskadyekhkvyacevthqglsspvtksfnrgegggsdykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x5xL (L:)
    sdieltqsplslpvslgdqasisctssqsllhsngdtylhwylqkpgqspklliytlsnr
    fsgvpdrfsgsgsgtdftlkisrveaadlgiyfcsqtthvpytfgggtkleikradaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnr