PDB entry 5x5u

View 5x5u on RCSB PDB site
Description: Crystal strcuture of alpha-ketoglutarate-semialdehyde dehydrogenase (KGSADH) complexed with NAD
Class: oxidoreductase
Keywords: alpha-ketoglutarate semialdehyde dehydrogenase, OXIDOREDUCTASE
Deposited on 2017-02-17, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ketoglutaric semialdehyde dehydrogenase
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: araE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x5ua_
  • Chain 'B':
    Compound: Alpha-ketoglutaric semialdehyde dehydrogenase
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: araE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x5ub_
  • Heterogens: NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x5uA (A:)
    msyyhhhhhhdydiptteniyfqgaanvtytdtqllidgewvdaasgktidvvnpatgkp
    igrvahagiadldralaaaqsgfeawrkvpaheraatmrkaaalvreradaiaqlmtqeq
    gkpltearvevlsaadiiewfadegrrvygrivpprnlgaqqtvvkepvgpvaaftpwnf
    pvnqvvrklsaalatgcsflvkapeetpaspaallrafvdagvpagviglvygdpaeiss
    yliphpvirkvtftgstpvgkqlaslaglhmkratmelgghapvivaedadvalavkaag
    gakfrnagqvcisptrflvhnsirdeftralvkhaeglkvgngleegttlgalanprrlt
    amasvidnarkvgasietggerigsegnffaptvianvpldadvfnnepfgpvaairgfd
    kleeaiaeanrlpfglagyaftrsfanvhlltqrlevgmlwinqpatpwpempfggvkds
    gygseggpealepylvtksvtvmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x5uA (A:)
    tytdtqllidgewvdaasgktidvvnpatgkpigrvahagiadldralaaaqsgfeawrk
    vpaheraatmrkaaalvreradaiaqlmtqeqgkpltearvevlsaadiiewfadegrrv
    ygrivpprnlgaqqtvvkepvgpvaaftpwnfpvnqvvrklsaalatgcsflvkapeetp
    aspaallrafvdagvpagviglvygdpaeissyliphpvirkvtftgstpvgkqlaslag
    lhmkratmelgghapvivaedadvalavkaaggakfrnagqvcisptrflvhnsirdeft
    ralvkhaeglkvgngleegttlgalanprrltamasvidnarkvgasietggerigsegn
    ffaptvianvpldadvfnnepfgpvaairgfdkleeaiaeanrlpfglagyaftrsfanv
    hlltqrlevgmlwinqpatpwpempfggvkdsgygseggpealepylvtksvtvma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x5uB (B:)
    msyyhhhhhhdydiptteniyfqgaanvtytdtqllidgewvdaasgktidvvnpatgkp
    igrvahagiadldralaaaqsgfeawrkvpaheraatmrkaaalvreradaiaqlmtqeq
    gkpltearvevlsaadiiewfadegrrvygrivpprnlgaqqtvvkepvgpvaaftpwnf
    pvnqvvrklsaalatgcsflvkapeetpaspaallrafvdagvpagviglvygdpaeiss
    yliphpvirkvtftgstpvgkqlaslaglhmkratmelgghapvivaedadvalavkaag
    gakfrnagqvcisptrflvhnsirdeftralvkhaeglkvgngleegttlgalanprrlt
    amasvidnarkvgasietggerigsegnffaptvianvpldadvfnnepfgpvaairgfd
    kleeaiaeanrlpfglagyaftrsfanvhlltqrlevgmlwinqpatpwpempfggvkds
    gygseggpealepylvtksvtvmav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x5uB (B:)
    tytdtqllidgewvdaasgktidvvnpatgkpigrvahagiadldralaaaqsgfeawrk
    vpaheraatmrkaaalvreradaiaqlmtqeqgkpltearvevlsaadiiewfadegrrv
    ygrivpprnlgaqqtvvkepvgpvaaftpwnfpvnqvvrklsaalatgcsflvkapeetp
    aspaallrafvdagvpagviglvygdpaeissyliphpvirkvtftgstpvgkqlaslag
    lhmkratmelgghapvivaedadvalavkaaggakfrnagqvcisptrflvhnsirdeft
    ralvkhaeglkvgngleegttlgalanprrltamasvidnarkvgasietggerigsegn
    ffaptvianvpldadvfnnepfgpvaairgfdkleeaiaeanrlpfglagyaftrsfanv
    hlltqrlevgmlwinqpatpwpempfggvkdsgygseggpealepylvtksvtvma