PDB entry 5x5j

View 5x5j on RCSB PDB site
Description: Crystal structure of response regulator AdeR receiver domain
Class: DNA binding protein
Keywords: bacterial signaling transduction, two-component regulatory system, response regulator, AdeR, DNA BINDING PROTEIN
Deposited on 2017-02-16, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AdeR
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x5ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x5jA (A:)
    mfdhsfsfdcqdkvilvveddydigdiienylkregmsviramngkqaielhasqpidli
    lldiklpelngwevlnkirqkaqtpvimltaldqdidkvmalrigaddfvvkpfnpnevi
    arvqavlrrtqfankat
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x5jA (A:)
    cqdkvilvveddydigdiienylkregmsviramngkqaielhasqpidlilldiklpel
    ngwevlnkirqkaqtpvimltaldidkvmalrigaddfvvkpfnpneviarvqavlrr