PDB entry 5x4l

View 5x4l on RCSB PDB site
Description: Crystal structure of the UBX domain of human UBXD7 in complex with p97 N domain
Class: hydrolase/protein binding
Keywords: UBXD7, p97, HYDROLASE-PROTEIN BINDING complex
Deposited on 2017-02-13, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55072 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5x4la1, d5x4la2, d5x4la3
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x4lb1, d5x4lb2
  • Chain 'C':
    Compound: UBX domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: UBXN7, KIAA0794, UBXD7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888 (Start-82)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5x4lc_
  • Chain 'D':
    Compound: UBX domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: UBXN7, KIAA0794, UBXD7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888 (Start-82)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5x4ld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x4lA (A:)
    ggspnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsd
    ekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyf
    leayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x4lA (A:)
    spnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdek
    irmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle
    ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x4lB (B:)
    ggspnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsd
    ekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyf
    leayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x4lB (B:)
    nrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdekir
    mnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfleay
    rpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x4lC (C:)
    ggsgpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshl
    dyditmqeaglcpqetvfvqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x4lC (C:)
    pkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldydi
    tmqeaglcpqetvfvqern
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5x4lD (D:)
    ggsgpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshl
    dyditmqeaglcpqetvfvqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x4lD (D:)
    pkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldydi
    tmqeaglcpqetvfvqern