PDB entry 5x4g

View 5x4g on RCSB PDB site
Description: Crystal structure of Fab fragment of anti-CD147 monoclonal antibody 6H8
Class: immune system
Keywords: antibody, Fab, CD147, IMMUNE SYSTEM
Deposited on 2017-02-13, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6H8 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X4G
  • Chain 'B':
    Compound: 6H8 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X4G
    Domains in SCOPe 2.07: d5x4gb1, d5x4gb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x4gB (B:)
    mdthtqvfisillwlygadgnivmtqspksmsmsvgervtlsckasenvgtyvswyqqkp
    eqspklliygasnrytgvpdrftgsgsatdftltissvqaedladyhcgqsysypftfgs
    gtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvl
    nswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x4gB (B:)
    nivmtqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsysypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne