PDB entry 5x3y

View 5x3y on RCSB PDB site
Description: Refined solution structure of musashi1 RBD2
Class: RNA binding protein
Keywords: RNA-binding protein, RRM, RBD, RNA BINDING PROTEIN
Deposited on 2017-02-09, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Musashi homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: Msi1, Msi1h
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61474 (4-95)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5x3ya1, d5x3ya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5x3yA (A:)
    gshmkkifvgglsvnttvedvkhyfeqfgkvddamlmfdkttnrhrgfgfvtfesedive
    kvceihfheinnkmveckkaqpkevmsptgsargrs