PDB entry 5x3p

View 5x3p on RCSB PDB site
Description: Crystal structure of the UBX domain of human UBXD7
Class: protein binding
Keywords: UBXD7, p97, PROTEIN BINDING
Deposited on 2017-02-06, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UBX domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: UBXN7, KIAA0794, UBXD7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888 (3-82)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5x3pa_
  • Chain 'B':
    Compound: UBX domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: UBXN7, KIAA0794, UBXD7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888 (3-End)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5x3pb_
  • Chain 'C':
    Compound: UBX domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: UBXN7, KIAA0794, UBXD7
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94888
      • engineered mutation (65)
    Domains in SCOPe 2.07: d5x3pc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x3pA (A:)
    ggsgpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshl
    dyditmqeaglcpqetvfvqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x3pA (A:)
    gpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldyd
    itmqeaglcpqetvfvqern
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x3pB (B:)
    ggsgpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshl
    dyditmqeaglcpqetvfvqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x3pB (B:)
    gpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldyd
    itmqeaglcpqetvfvqer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x3pC (C:)
    ggsgpkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshl
    dyditmqeaglcpqetvfvqern
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x3pC (C:)
    pkaqlmlrypdgkreqitlpeqakllalvkhvqskgypnerfelltnfprrklshldydi
    tmqeaglcpqetvfvqer