PDB entry 5x2b

View 5x2b on RCSB PDB site
Description: Crystal structure of mouse sulfotransferase SULT7A1 complexed with PAP
Class: transferase
Keywords: transferase
Deposited on 2017-01-31, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (1-281)
      • conflict (257)
    Domains in SCOPe 2.07: d5x2ba_
  • Chain 'B':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4
      • conflict (257)
    Domains in SCOPe 2.07: d5x2bb_
  • Chain 'C':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (1-281)
      • conflict (257)
      • expression tag (282)
    Domains in SCOPe 2.07: d5x2bc1, d5x2bc2
  • Chain 'D':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (2-End)
      • expression tag (0-1)
      • conflict (255)
    Domains in SCOPe 2.07: d5x2bd1, d5x2bd2
  • Chain 'E':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4
      • conflict (257)
    Domains in SCOPe 2.07: d5x2be_
  • Chain 'F':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (Start-280)
      • conflict (256)
      • expression tag (281)
    Domains in SCOPe 2.07: d5x2bf1, d5x2bf2
  • Chain 'G':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4
      • conflict (256)
    Domains in SCOPe 2.07: d5x2bg_
  • Chain 'H':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (Start-280)
      • conflict (256)
      • expression tag (281)
    Domains in SCOPe 2.07: d5x2bh1, d5x2bh2
  • Chain 'I':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4
      • conflict (257)
    Domains in SCOPe 2.07: d5x2bi_
  • Chain 'J':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4
      • conflict (256)
    Domains in SCOPe 2.07: d5x2bj_
  • Chain 'K':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (1-281)
      • conflict (257)
    Domains in SCOPe 2.07: d5x2bk_
  • Chain 'L':
    Compound: sulfotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Sult6b2, Gm766
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7ZWN4 (1-281)
      • expression tag (0)
      • conflict (257)
      • expression tag (282)
    Domains in SCOPe 2.07: d5x2bl1, d5x2bl2, d5x2bl3
  • Heterogens: A3P, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x2bA (A:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bA (A:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x2bB (B:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bB (B:)
    sllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakepnhvicaltsdrnlvfrkgvvg
    dwinyftpkqnrgfdelftekmrnsdvgrclkeya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5x2bC (C:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bC (C:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5x2bD (D:)
    ailhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrkg
    vvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bD (D:)
    ailhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakencnhvicaltsdrnlvfrkgvv
    gdwinyftpkqnrgfdelftekmrnsdvgrclkeya
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5x2bE (E:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bE (E:)
    llhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitlt
    spielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfhy
    yrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfvk
    slkkitaflgidvndsemakiarstsfsemksnaakncdpnhvicaltsdrnlvfrkgvv
    gdwinyftpkqnrgfdelftekmrnsdvgrclkeyah
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5x2bF (F:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bF (F:)
    sllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakenpnhvicaltsdrnlvfrkgvv
    gdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5x2bG (G:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bG (G:)
    sllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakencnhvicaltsdrnlvfrkgvv
    gdwinyftpkqnrgfdelftekmrnsdvgrclkeya
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5x2bH (H:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bH (H:)
    sllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakdpnhvicaltsdrnlvfrkgvvg
    dwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5x2bI (I:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bI (I:)
    llhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitlt
    spielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfhy
    yrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfvk
    slkkitaflgidvndsemakiarstsfsemksnaakncdpnhvicaltsdrnlvfrkgvv
    gdwinyftpkqnrgfdelftekmrnsdvgrclkeyah
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5x2bJ (J:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bJ (J:)
    sllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagitl
    tspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmfh
    yyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdfv
    kslkkitaflgidvndsemakiarstsfsemksnaakpnhvicaltsdrnlvfrkgvvgd
    winyftpkqnrgfdelftekmrnsdvgrclkeya
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5x2bK (K:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x2bK (K:)
    psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
    ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
    hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
    vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
    gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5x2bL (L:)
    apsllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagi
    tltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsm
    fhyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkd
    fvkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfr
    kgvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahsa