PDB entry 5x23

View 5x23 on RCSB PDB site
Description: Crystal structure of CYP2C9 genetic variant A477T (*30) in complex with multiple losartan molecules
Class: oxidoreductase
Keywords: oxidoreductase, CYP2C9 polymorphic mutant, Single Nucleotide Polymorphism, P450 2C9 genetic variant
Deposited on 2017-01-30, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2C9
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C9, CYP2C10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11712 (Start-471)
      • engineered mutation (458)
      • engineered mutation (471)
    Domains in SCOPe 2.07: d5x23a_
  • Heterogens: HEM, LSN, PO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x23A (A:)
    makktsgrgklppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlh
    gyeavkealidlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgk
    rsiedrvqeearclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlm
    eklnenikilsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmn
    npqdfidcflmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpe
    vtakvqeeiervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrn
    ylipkgttilisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvge
    alagmelflfltsilqnfnlkslvdpknldttpvvngftsvppfyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x23A (A:)
    klppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkeal
    idlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqe
    earclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklneniki
    lsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcf
    lmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeei
    ervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgtti
    lisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelfl
    fltsilqnfnlkslvdpknldttpvvngftsvppfyqlcfipi