PDB entry 5x14

View 5x14 on RCSB PDB site
Description: Crystal structure of Bacillus subtilis PadR in complex with ferulic acid
Class: transcription
Keywords: Transcription factor, TRANSCRIPTION
Deposited on 2017-01-24, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Bacillus subtilis subsp. spizizenii strain W23 [TaxId:655816]
    Gene: padR, BSUW23_04210
    Database cross-references and differences (RAF-indexed):
    • Uniprot E0TW95 (6-187)
      • expression tag (2-5)
    Domains in SCOPe 2.07: d5x14a1, d5x14a2
  • Heterogens: FER, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x14A (A:)
    gsakdpmrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfi
    tfrttiqgtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeas
    dlftdqllkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswles
    ilamided
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x14A (A:)
    akdpmrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitf
    rkkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrk
    aklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamided