PDB entry 5x0t

View 5x0t on RCSB PDB site
Description: Crystal structure of CD147 C2 domain in complex with Fab of its monoclonal antibody 6H8
Class: immune system
Keywords: CD147, monoclonal antibody, IMMUNE SYSTEM
Deposited on 2017-01-23, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6H8 Fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X0T
  • Chain 'B':
    Compound: 6H8 Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X0T
    Domains in SCOPe 2.07: d5x0tb1, d5x0tb2
  • Chain 'C':
    Compound: 6H8 Fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X0T
  • Chain 'D':
    Compound: 6H8 Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5X0T
    Domains in SCOPe 2.07: d5x0td1, d5x0td2
  • Chain 'E':
    Compound: Basigin
    Species: Homo sapiens [TaxId:9606]
    Gene: BSG, UNQ6505/PRO21383
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35613 (Start-80)
      • expression tag (81)
  • Chain 'F':
    Compound: Basigin
    Species: Homo sapiens [TaxId:9606]
    Gene: BSG, UNQ6505/PRO21383
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35613 (Start-80)
      • expression tag (81)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x0tB (B:)
    mdthtqvfisillwlygadgnivmtqspksmsmsvgervtlsckasenvgtyvswyqqkp
    eqspklliygasnrytgvpdrftgsgsatdftltissvqaedladyhcgqsysypftfgs
    gtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvl
    nswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x0tB (B:)
    nivmtqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsysypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5x0tD (D:)
    mdthtqvfisillwlygadgnivmtqspksmsmsvgervtlsckasenvgtyvswyqqkp
    eqspklliygasnrytgvpdrftgsgsatdftltissvqaedladyhcgqsysypftfgs
    gtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvl
    nswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x0tD (D:)
    nivmtqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsysypftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.