PDB entry 5x08

View 5x08 on RCSB PDB site
Description: Crystal structure of broadly neutralizing anti-HIV-1 antibody 4E10, mutant Npro, with peptide bound
Class: immune system
Keywords: broadly neutralizing antibody, MPER, IMMUNE SYSTEM
Deposited on 2017-01-20, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab 4E10 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 5X08 (0-End)
  • Chain 'L':
    Compound: fab 4e10 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGG1
    Database cross-references and differences (RAF-indexed):
    • PDB 5X08 (0-End)
    Domains in SCOPe 2.06: d5x08l1, d5x08l2
  • Chain 'P':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus type 1 (MAL ISOLATE) [TaxId:11697]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • PDB 5X08 (0-End)
  • Heterogens: GOL, PGE, P6G, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >5x08L (L:)
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrge

    Sequence, based on observed residues (ATOM records): (download) 
    >5x08L (L:)
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevkrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnr

  • Chain 'P':
    No sequence available.