PDB entry 5wzv

View 5wzv on RCSB PDB site
Description: Crystal structure of human secreted phospholipase A2 group IIE with Me-indoxam
Class: hydrolase/inhibitor
Keywords: phospholipase A2, inhibitor, HYDROLASE-INHIBITOR complex
Deposited on 2017-01-18, released 2018-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Group IIE secretory phospholipase A2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G2E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wzva_
  • Heterogens: CA, 7W0, GOL, DMS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wzvA (A:)
    nlvqfgvmiekmtgksalqyndygcycgiggshwpvdqtdwcchahdccygrleklgcep
    klekylfsvsergifcagrttcqrltcecdkraalcfrrnlgtynrkyahypnklctgpt
    ppc