PDB entry 5wyq

View 5wyq on RCSB PDB site
Description: Crystal Structure and catalytic mechanism of the essential m1G37 tRNA methyltransferase TrmD from Pseudomonas aeruginosa
Class: transferase
Keywords: Pseudomonas aeruginosa PA14, tRNA (m1G37) methyltransferase, TrmD, tDNA modification, TRANSFERASE
Deposited on 2017-01-15, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: trmD, PA14_15990
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02RL6 (2-247)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5wyqa1, d5wyqa2
  • Chain 'B':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: trmD, PA14_15990
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02RL6 (2-247)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5wyqb1, d5wyqb2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wyqA (A:)
    smlwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggp
    gmvmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryeg
    iderfieehvdeewsigdyvlsggelpamvlvdavtrllpgalghadsaeedsftdglld
    cphytrpevyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkll
    aeyirqrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wyqA (A:)
    smlwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggp
    gmvmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryeg
    iderfieehvdeewsigdyvlsggelpamvlvdavtrllpgalftdglldcphytrpevy
    adkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllaeyirqrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wyqB (B:)
    smlwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggp
    gmvmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryeg
    iderfieehvdeewsigdyvlsggelpamvlvdavtrllpgalghadsaeedsftdglld
    cphytrpevyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkll
    aeyirqrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wyqB (B:)
    smlwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggp
    gmvmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryeg
    iderfieehvdeewsigdyvlsggelpamvlvdavtrllpgaldsftdglldcphytrpe
    vyadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllaeyirqrd