PDB entry 5wvx

View 5wvx on RCSB PDB site
Description: Crystal Structure of bifunctional Kunitz type Trypsin /amylase inhibitor (AMTIN) from the tubers of Alocasia macrorrhiza
Class: hydrolase inhibitor
Keywords: Kunitz type Trypsin inhibitor, Alpha amylase inhibitor, HYDROLASE INHIBITOR
Deposited on 2016-12-29, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin/chymotrypsin inhibitor
    Species: Alocasia macrorrhizos [TaxId:4456]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wvxa_
  • Chain 'B':
    Compound: Trypsin/chymotrypsin inhibitor
    Species: Alocasia macrorrhizos [TaxId:4456]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wvxb_
  • Heterogens: NGA, CIT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wvxA (A:)
    tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
    enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
    agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvk
    vkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wvxA (A:)
    tnpvldvdgnelqrgqlyyatsvmrggltlaapkgcplnvaqapfdeysgrplaffpena
    dddtvqegstlyimfpeptrcpqstvwtfdrtggttskaigphnsrfairkagdasyqie
    vcpcstgverpscrmgtlglaeggknvllninnesph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wvxB (B:)
    tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
    enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
    agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvk
    vkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wvxB (B:)
    tnpvldvdgnelqrgqlyyatsvmgggltlaapkgcplnvaqaysgrplaffpenadddt
    vqegstlyimfpeptrcpqstvwtfdretggttskaigphnsrfairkagdasyqievcp
    csgverpscrmgtlglaeggknvllninnesph