PDB entry 5wsz

View 5wsz on RCSB PDB site
Description: Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis
Class: oxidoreductase
Keywords: copper-dependent, monooxygenase, AA10, OXIDOREDUCTASE
Deposited on 2016-12-08, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LpmO10A
    Species: Bacillus thuringiensis subsp. kurstaki [TaxId:29339]
    Gene: lpmO10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wsza_
  • Chain 'B':
    Compound: LpmO10A
    Species: Bacillus thuringiensis subsp. kurstaki [TaxId:29339]
    Gene: lpmO10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wszb_
  • Chain 'C':
    Compound: LpmO10A
    Species: Bacillus thuringiensis subsp. kurstaki [TaxId:29339]
    Gene: lpmO10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wszc_
  • Chain 'D':
    Compound: LpmO10A
    Species: Bacillus thuringiensis subsp. kurstaki [TaxId:29339]
    Gene: lpmO10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wszd_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wszA (A:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnllnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wszB (B:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnllnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wszB (B:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wszC (C:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnllnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wszC (C:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wszD (D:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnllnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wszD (D:)
    hgyvespasrsylckqgvnvncgpiqyepqsvegiggfpqlgpsdgqiagaghfpaldvq
    tvdrwkkvtlnggtntfkwkltaphstkewkyyitkkgwnpnkpltrsdldlvpfyvknd
    ggarpgttvtheanvptdrsgyhlilavweiadtgnafyqvidvnlln