PDB entry 5wsl

View 5wsl on RCSB PDB site
Description: Structural studies of keratinase from Meiothermus taiwanensis WR-220
Class: hydrolase
Keywords: keratainase, protease, HYDROLASE
Deposited on 2016-12-07, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: keratinase
    Species: Meiothermus taiwanensis WR-220 [TaxId:1339250]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WSL (0-End)
    Domains in SCOPe 2.07: d5wsla_
  • Chain 'B':
    Compound: keratinase
    Species: Meiothermus taiwanensis WR-220 [TaxId:1339250]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WSL (0-End)
    Domains in SCOPe 2.07: d5wslb_
  • Chain 'C':
    Compound: keratinase
    Species: Meiothermus taiwanensis WR-220 [TaxId:1339250]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WSL (0-End)
    Domains in SCOPe 2.07: d5wslc_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wslA (A:)
    atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
    gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
    arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
    ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
    npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wslA (A:)
    atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
    gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
    arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
    ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
    npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wslB (B:)
    atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
    gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
    arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
    ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
    npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wslB (B:)
    atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
    gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
    arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
    ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
    npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenly
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wslC (C:)
    atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
    gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
    arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
    ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
    npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wslC (C:)
    atqtgatwgldridqrtlplsgtftysntgsgvnayiidtgirvshsefggratavfdai
    gdgqngndcnghgthvagtvggtvygvaksvrlyavrvlncsgsgsnsgviagvdwvrqn
    arrpavanmslgggassaldtavnnainagitfalaagnsnrdacqfsparvtagitvga
    ttstdarasysnygscldlfapgssitsawissdtstntisgtsmatphvagvaalylqs
    npsaspatvrnaivgnatsgvvsnagrrspnlllysnyenly