PDB entry 5wro

View 5wro on RCSB PDB site
Description: Crystal structure of Drosophila enolase
Class: lyase
Keywords: enolase, hydrolyase, metabolism, LYASE
Deposited on 2016-12-02, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Eno, CG17654
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15007 (7-438)
      • expression tag (0-6)
    Domains in SCOPe 2.07: d5wroa1, d5wroa2, d5wroa3
  • Heterogens: CD, CO, CL, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wroA (A:)
    gamdpeftikaikarqiydsrgnptvevdlttelglfraavpsgastgvhealelrdndk
    anyhgksvlkavghvndtlgpelikanldvvdqasidnfmikldgtenkskfganailgv
    slavakagaakkgvplykhiadlagnkeiilpvpafnvinggshagnklamqefmilptg
    atsfteamkmgsevyhhlknvikakfgldatavgdeggfapniqsnkealnlisdaiaka
    gytgkieigmdvaasefykdgqydldfkneksdksqwlpadklanlyqefikdfpivsie
    dpfdqdhweawsnltgctdiqivgddltvtnpkriatavekkacnclllkvnqigtvtes
    iaahllakkngwgtmvshrsgetedsfigdlvvglstgqiktgapcrserlakynqilri
    eeeigagvkfagksfrkpq