PDB entry 5wqv

View 5wqv on RCSB PDB site
Description: Crystal structure of PriB mutant - S55A
Class: DNA binding protein
Keywords: DNA binding protein, Bacterial DNA replication, OB-fold, S55A mutant
Deposited on 2016-11-28, released 2017-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: primosomal replication protein n
    Species: Escherichia coli (strain K12) [TaxId:595496]
    Gene: priB, BWG_3913
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4ZR78
      • engineered mutation (54)
    Domains in SCOPe 2.08: d5wqva_
  • Chain 'B':
    Compound: primosomal replication protein n
    Species: Escherichia coli (strain K12) [TaxId:595496]
    Gene: priB, BWG_3913
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4ZR78
      • engineered mutation (54)
    Domains in SCOPe 2.08: d5wqvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5wqvA (A:)
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenq
aithsitvgsritvqgfischkaknglskmvlhaeqielidsgd

    Sequence, based on observed residues (ATOM records): (download) 
    >5wqvA (A:)
tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenqa
ithsitvgsritvqgfischkskmvlhaeqieli

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5wqvB (B:)
mtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenq
aithsitvgsritvqgfischkaknglskmvlhaeqielidsgd

    Sequence, based on observed residues (ATOM records): (download) 
    >5wqvB (B:)
tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivaghenqa
ithsitvgsritvqgfischkmvlhaeqiel