PDB entry 5wq4

View 5wq4 on RCSB PDB site
Description: Crystal structure of OPTN and linear diubiquitin complex
Class: signaling protein/protein binding
Keywords: Optineurin, linear diubiquitin, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2016-11-23, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wq4a1, d5wq4a2
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wq4b1, d5wq4b2
  • Chain 'C':
    Compound: Optineurin
    Species: Mus musculus [TaxId:10090]
    Gene: Optn
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Optineurin
    Species: Mus musculus [TaxId:10090]
    Gene: Optn
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Optineurin
    Species: Mus musculus [TaxId:10090]
    Gene: Optn
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Optineurin
    Species: Mus musculus [TaxId:10090]
    Gene: Optn
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wq4A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq4A (A:)
    ktltgktitlevepsdienvkakiqdkegippdqqrlifagkqletlsdyniqkestlhl
    vlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wq4B (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq4B (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrggmqifvktltgktitlevepsdtienvkakiqdkegippdqqrli
    fagkqledgrtlsdyniqkestlhlvlrlrg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.