PDB entry 5wph

View 5wph on RCSB PDB site
Description: Crystal structure of ArsN, N-acetyltransferase with substrate AST from Pseudomonas putida KT2440
Class: transferase
Keywords: N-acetyltransferase, Pseudomonas putida, TRANSFERASE
Deposited on 2017-08-04, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphinothricin N-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wpha_
  • Chain 'B':
    Compound: Phosphinothricin N-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wphb_
  • Chain 'C':
    Compound: Phosphinothricin N-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wphc_
  • Chain 'D':
    Compound: Phosphinothricin N-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wphd_
  • Chain 'E':
    Compound: Phosphinothricin N-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wphe_
  • Chain 'F':
    Compound: Phosphinothricin N-acetyltransferase
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_1924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wphf_
  • Heterogens: BLJ, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wphA (A:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wphA (A:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgflsqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wphB (B:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wphB (B:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgflsqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wphC (C:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wphC (C:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wphD (D:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wphD (D:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgflsq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5wphE (E:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wphE (E:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgflsq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5wphF (F:)
    mhsgidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvav
    regrvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsay
    agialpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgfls
    qiplgpeqkliseedlnsavdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wphF (F:)
    gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg
    rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi
    alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplgflsqi