PDB entry 5wp2

View 5wp2 on RCSB PDB site
Description: 1.44 Angstrom crystal structure of CYP121 from Mycobacterium tuberculosis in complex with substrate and CN
Class: oxidoreductase
Keywords: complex, P450, OXIDOREDUCTASE
Deposited on 2017-08-03, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mycocyclosin synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: cyp121, MT2336
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wp2a_
  • Heterogens: HEM, YTT, CYN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wp2A (A:)
    tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
    mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
    dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
    wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
    lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
    gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
    llkkmpgvdlavpidqlvwrtrfqrriperlpvlw