PDB entry 5woo

View 5woo on RCSB PDB site
Description: The crystal structure of the Staphylococcus aureus Fatty acid Kinase (Fak) B1 protein loaded with Myristic acid (C14:0) to 1.78 Angstrom resolution
Class: transferase
Keywords: Staphylococcus aureus, FakB1, myristic acid, C14:0, TRANSFERASE
Deposited on 2017-08-02, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EDD domain protein, DegV family
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AYM28_04055, AYM37_04055, ERS072738_00223, ERS072840_01626, ERS074020_00218, HMPREF3211_01094
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wooa_
  • Chain 'B':
    Compound: EDD domain protein, DegV family
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AYM28_04055, AYM37_04055, ERS072738_00223, ERS072840_01626, ERS074020_00218, HMPREF3211_01094
    Database cross-references and differences (RAF-indexed):
    • Uniprot X5EH37 (6-293)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d5woob1, d5woob2
  • Heterogens: MYR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wooA (A:)
    vprgshmkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkma
    ssqtipttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvh
    afdsklaamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgri
    tgaqawvgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvin
    gdhfedgqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wooA (A:)
    mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
    ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
    aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritgaqaw
    vgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfed
    gqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wooB (B:)
    vprgshmkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkma
    ssqtipttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvh
    afdsklaamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgri
    tgaqawvgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvin
    gdhfedgqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wooB (B:)
    vprgshmkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkma
    ssqtipttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvh
    afdsklaamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgri
    tgllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfedg
    qalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt