PDB entry 5wih

View 5wih on RCSB PDB site
Description: Structure of New Delhi Metallo-Beta-lactamase 12 (NDM-12)
Class: hydrolase
Keywords: lactamase, HYDROLASE
Deposited on 2017-07-19, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase NDM-12
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wiha_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wihA (A:)
    mgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
    ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhs
    ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
    lddadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wihA (A:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    ddadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr