PDB entry 5wic

View 5wic on RCSB PDB site
Description: TraE protein in complex with 2-Furoic Acid (FOA)
Class: protein transport
Keywords: Type IV Secretion System, Fragment-Based Drug Design, Complex, Inhibitor, Antimicrobial Resistance, Bacterial secretion, VirB, PROTEIN TRANSPORT
Deposited on 2017-07-19, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conjugal transfer protein
    Species: Escherichia coli [TaxId:562]
    Gene: traE, B634_00049, BE957_00530, ECONIH1_27615, pec386IL_00125, pEcNDM0_00049, pHKU1_33, pKC394-028, pKC396-021, pMUR050_041, pN3_023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wica_
  • Chain 'B':
    Compound: Conjugal transfer protein
    Species: Escherichia coli [TaxId:562]
    Gene: traE, B634_00049, BE957_00530, ECONIH1_27615, pec386IL_00125, pEcNDM0_00049, pHKU1_33, pKC394-028, pKC396-021, pMUR050_041, pN3_023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wicb_
  • Chain 'C':
    Compound: Conjugal transfer protein
    Species: Escherichia coli [TaxId:562]
    Gene: traE, B634_00049, BE957_00530, ECONIH1_27615, pec386IL_00125, pEcNDM0_00049, pHKU1_33, pKC394-028, pKC396-021, pMUR050_041, pN3_023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wicc_
  • Chain 'D':
    Compound: Conjugal transfer protein
    Species: Escherichia coli [TaxId:562]
    Gene: traE, B634_00049, BE957_00530, ECONIH1_27615, pec386IL_00125, pEcNDM0_00049, pHKU1_33, pKC394-028, pKC396-021, pMUR050_041, pN3_023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wicd_
  • Heterogens: FOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wicA (A:)
    ahlltlneathevqqvkltrdqtsygdeidkfwltqyvihresydfysvqvdytavglms
    tpnvaesyqskfkgrngldkvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvd
    dqpqrwiaimgyeykslamnaeqryvnplgfrvtsyrvnpevn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wicA (A:)
    trdqtsygdeidkfwltqyvihresydfysvqvdytavglmstpnvaesyqskfkgrngl
    dkvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvddqpqrwiaimgyeyksla
    mnaeqryvnplgfrvtsyrvnpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wicB (B:)
    ahlltlneathevqqvkltrdqtsygdeidkfwltqyvihresydfysvqvdytavglms
    tpnvaesyqskfkgrngldkvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvd
    dqpqrwiaimgyeykslamnaeqryvnplgfrvtsyrvnpevn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wicB (B:)
    rdqtsygdeidkfwltqyvihresydfysvqvdytavglmstpnvaesyqskfkgrngld
    kvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvddqpqrwiaimgyeykslam
    naeqryvnplgfrvtsyrvnpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wicC (C:)
    ahlltlneathevqqvkltrdqtsygdeidkfwltqyvihresydfysvqvdytavglms
    tpnvaesyqskfkgrngldkvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvd
    dqpqrwiaimgyeykslamnaeqryvnplgfrvtsyrvnpevn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wicC (C:)
    ygdeidkfwltqyvihresydfysvqvdytavglmstpnvaesyqskfkgrngldkvlgd
    settrvkinsvildkphgvatirfttvrrvrsnpvddqpqrwiaimgyeykslamnaeqr
    yvnplgfrvtsyrvnpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wicD (D:)
    ahlltlneathevqqvkltrdqtsygdeidkfwltqyvihresydfysvqvdytavglms
    tpnvaesyqskfkgrngldkvlgdsettrvkinsvildkphgvatirfttvrrvrsnpvd
    dqpqrwiaimgyeykslamnaeqryvnplgfrvtsyrvnpevn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wicD (D:)
    ygdeidkfwltqyvihresydfysvqvdytavglmstpnvaesyqskfkgrngldkvlgd
    settrvkinsvildkphgvatirfttvrrvrsnpvddqpqrwiaimgyeykslamnaeqr
    yvnplgfrvtsyrvnpe