PDB entry 5wi9

View 5wi9 on RCSB PDB site
Description: Crystal structure of KL with an agonist Fab
Class: structural protein
Keywords: beta-klotho, scaffold protein, fibroblast growth factors, STRUCTURAL PROTEIN
Deposited on 2017-07-18, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-klotho
    Species: Homo sapiens [TaxId:9606]
    Gene: KLB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-klotho
    Species: Homo sapiens [TaxId:9606]
    Gene: KLB
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 39F7 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5WI9 (0-End)
    Domains in SCOPe 2.07: d5wi9e1, d5wi9e2
  • Chain 'F':
    Compound: 39F7 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5WI9 (Start-224)
  • Chain 'H':
    Compound: 39F7 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5WI9 (Start-224)
  • Chain 'L':
    Compound: 39F7 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5WI9 (0-End)
    Domains in SCOPe 2.07: d5wi9l1, d5wi9l2
  • Heterogens: NAG, EDO, SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5wi9E (E:)
    eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsgsspltfgggteveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wi9E (E:)
    eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsgsspltfgggteveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5wi9L (L:)
    eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsgsspltfgggteveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wi9L (L:)
    eivltqspgtlslspgeratlscrasqsvsstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqsgsspltfgggteveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreansqesvteqdskdstyslsstltlskadycevthq
    glsspvtk