PDB entry 5wh9

View 5wh9 on RCSB PDB site
Description: Structure of BH1999 gentisyl-coenzyme A thioesterase
Class: hydrolase
Keywords: Gentisyl CoA Thioesterase, Hotdog Fold, HYDROLASE
Deposited on 2017-07-16, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH1999
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wh9a_
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH1999
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wh9b_
  • Chain 'C':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH1999
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wh9c_
  • Chain 'D':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH1999
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wh9d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wh9A (A:)
    megkvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpivea
    tcqfkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklav
    cpipssvrvafanigtce
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wh9A (A:)
    kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
    fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwacpipssvrvafa
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wh9B (B:)
    megkvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpivea
    tcqfkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklav
    cpipssvrvafanigtce
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wh9B (B:)
    vyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcqf
    kapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanavcpipssvrva
    fan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wh9C (C:)
    megkvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpivea
    tcqfkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklav
    cpipssvrvafanigtce
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wh9C (C:)
    kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
    fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfklavcpipss
    vrv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wh9D (D:)
    megkvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpivea
    tcqfkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfsngklav
    cpipssvrvafanigtce
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wh9D (D:)
    kvyhfrvkfgdtdaagivfypnyykwmdeachhfltelgfptselidkkigfpiveatcq
    fkapllfadhvfirtsirelkdksfilehhfikqgrviasghekrvwanfavcpipssvr
    vafa