PDB entry 5wfx

View 5wfx on RCSB PDB site
Description: Structural basis for the interaction of 14-3-3beta with Tricarboxylic Acid Cycle intermediate Malate
Class: protein transport
Keywords: ChREBP, transcription activation, PROTEIN TRANSPORT
Deposited on 2017-07-12, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wfxa_
  • Chain 'B':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wfxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wfxA (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wfxA (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wfxB (B:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wfxB (B:)
    mdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrsswr
    vissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfylk
    mkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse