PDB entry 5wds

View 5wds on RCSB PDB site
Description: Choanoflagellate Salpingoeca rosetta Ras with GDP bound
Class: oncoprotein, hydrolase
Keywords: small G-protein, GTPase, ONCOPROTEIN, HYDROLASE
Deposited on 2017-07-05, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras protein
    Species: Salpingoeca rosetta [TaxId:28009]
    Gene: PTSG_05504
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2UBE5 (4-170)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d5wdsa1, d5wdsa2
  • Chain 'B':
    Compound: Ras protein
    Species: Salpingoeca rosetta [TaxId:28009]
    Gene: PTSG_05504
    Database cross-references and differences (RAF-indexed):
    • Uniprot F2UBE5 (4-170)
      • expression tag (3)
    Domains in SCOPe 2.07: d5wdsb1, d5wdsb2
  • Heterogens: GDP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wdsA (A:)
    gamamteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldil
    dtagqedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgn
    kcdleehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdsA (A:)
    mamteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldildt
    agqedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgnkc
    dleehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wdsB (B:)
    gamamteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldil
    dtagqedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgn
    kcdleehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdsB (B:)
    amteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldildta
    gqedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgnkcd
    leehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky