PDB entry 5wdr

View 5wdr on RCSB PDB site
Description: Choanoflagellate Salpingoeca rosetta Ras with GMP-PNP
Class: oncoprotein, hydrolase
Keywords: small G-protein, GTPase, ONCOPROTEIN, HYDROLASE
Deposited on 2017-07-05, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras protein
    Species: Salpingoeca rosetta [TaxId:28009]
    Gene: PTSG_05504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wdra_
  • Chain 'B':
    Compound: Ras protein
    Species: Salpingoeca rosetta [TaxId:28009]
    Gene: PTSG_05504
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wdrb_
  • Heterogens: MG, NA, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wdrA (A:)
    gamamteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldil
    dtagqedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgn
    kcdleehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdrA (A:)
    mteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldildtag
    qedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgnkcdl
    eehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wdrB (B:)
    gamamteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldil
    dtagqedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgn
    kcdleehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdrB (B:)
    mteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldildtag
    qedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgnkcdl
    eehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky