PDB entry 5wdp

View 5wdp on RCSB PDB site
Description: H-Ras mutant L120A bound to GMP-PNP at 277K
Class: oncoprotein, hydrolase
Keywords: small G-protein, GTPase, ONCOPROTEIN, HYDROLASE
Deposited on 2017-07-05, released 2017-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (119)
    Domains in SCOPe 2.06: d5wdpa_
  • Heterogens: CA, GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5wdpA (A:)
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcda
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh