PDB entry 5wdg

View 5wdg on RCSB PDB site
Description: Acetolactate Synthase from Klebsiella pneumoniae in Complex with a Reaction Intermediate
Class: transferase
Keywords: Intermediate, Synthase, ThDP, TRANSFERASE
Deposited on 2017-07-05, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: budB, ilvK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27696
      • conflict (426)
    Domains in SCOPe 2.07: d5wdga1, d5wdga2, d5wdga3
  • Chain 'B':
    Compound: Acetolactate synthase, catabolic
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: budB, ilvK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27696 (20-End)
      • expression tag (15-19)
      • conflict (426)
    Domains in SCOPe 2.07: d5wdgb1, d5wdgb2, d5wdgb3, d5wdgb4
  • Heterogens: MG, PO4, A4Y, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wdgA (A:)
    mgsshhhhhhssglvprgshmdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkv
    fdslldssiriipvrheanaafmaaavgritgkagvalvtsgpgcsnlitgmatansegd
    pvvalggavkradkakqvhqsmdtvamfspvtkyaievtapdalaevvsnafraaeqgrp
    gsafvslpqdvvdgpvsgkvlpasgapqmgaapddaidqvakliaqaknpifllglmasq
    penskalrrlletshipvtstyqaagavnqdnfsrfagrvglfnnqagdrllqladlvic
    igyspveyepamwnsgnatlvhidvlpayeernytpdvelvgdiagtlnklaqnidhrlv
    lspqaaeilrdrqhqrelldrrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiw
    iarylysfrarqvmisngqqtmgvalpwaigawlvnperkvvsvsgdggflqssmeleta
    vrlkanvlhliwvdngynmvaiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaea
    leptlraamdvdgpavvaipvdyrdnpllmgqlhlsqil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdgA (A:)
    pvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafmaa
    avgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkmdtvamfspvt
    kyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpaqmgaapdda
    idqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaagavnqdnfsrf
    agrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlpayeernytp
    dvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaqlnqfalhplri
    vramqdivnsdvtltvdmgsfhiwiarylysfrarqvmisngqqtmgvalpwaigawlvn
    perkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeekkyqrlsgvef
    gpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdnpllmgqlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wdgB (B:)
    mgsshhhhhhssglvprgshmdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkv
    fdslldssiriipvrheanaafmaaavgritgkagvalvtsgpgcsnlitgmatansegd
    pvvalggavkradkakqvhqsmdtvamfspvtkyaievtapdalaevvsnafraaeqgrp
    gsafvslpqdvvdgpvsgkvlpasgapqmgaapddaidqvakliaqaknpifllglmasq
    penskalrrlletshipvtstyqaagavnqdnfsrfagrvglfnnqagdrllqladlvic
    igyspveyepamwnsgnatlvhidvlpayeernytpdvelvgdiagtlnklaqnidhrlv
    lspqaaeilrdrqhqrelldrrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiw
    iarylysfrarqvmisngqqtmgvalpwaigawlvnperkvvsvsgdggflqssmeleta
    vrlkanvlhliwvdngynmvaiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaea
    leptlraamdvdgpavvaipvdyrdnpllmgqlhlsqil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdgB (B:)
    prgshmdkqypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvr
    heanaafmaaavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradka
    kqvhqsmdtvamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgp
    vsgkvlpasgapqmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletsh
    ipvtstyqaagavnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwns
    gnatlvhidvlpayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhq
    rrgaqlnqfalhplrivramqdivnsdvtltvdmgsfhiwiarylysfrarqvmisngqq
    tmgvalpwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmv
    aiqeekkyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaip
    vdyrdnpllmgqlh