PDB entry 5wde

View 5wde on RCSB PDB site
Description: Crystal structure of the KIFC3 motor domain in complex with ADP
Class: motor protein
Keywords: kinesin, motor domain, adp, STRUCTURAL GENOMICS, STRUCTUR AL GENOMICS CONSORTIUM, SGC, Structural Genomics Consortium, MOTOR PROTEIN
Deposited on 2017-07-05, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIFC3
    Species: Homo sapiens [TaxId:9606]
    Gene: KIFC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wdea_
  • Heterogens: ADP, MG, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wdeA (A:)
    gskgnirviarvrpvtkedgegpeatnavtfdadddsiihllhkgkpvsfeldkvfspqa
    sqqdvfqevqalvtscidgfnvcifaygqtgagktytmegtaenpginqralqllfsevq
    ekasdweytitvsaaeiynevlrdllgkepqekleirlcpdgsgqlyvpgltefqvqsvd
    dinkvfefghtnrtteftnlnehssrshallivtvrgvdcstglrttgklnlvdlagser
    vgksgaegsrlreaqhinkslsalgdviaalrsrqghvpfrnskltyllqdslsgdsktl
    mvvqvspvekntsetlyslkfaervrsvel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wdeA (A:)
    nirviarvrpvtkedgegpeatnavtfdadddsiihllhkgkpvsfeldkvfspqasqqd
    vfqevqalvtscidgfnvcifaygqtgagktytmegtaenpginqralqllfsevqekas
    dweytitvsaaeiynevlrdllgkepqekleirlcpdgsgqlyvpgltefqvqsvddink
    vfefghtnrtteftnlnehssrshallivtvrgvdcstglrttgklnlvdlagservgke
    gsrlreaqhinkslsalgdviaalrsrqghvpfrnskltyllqdslsgdsktlmvvqvsp
    vekntsetlyslkfaervrs