PDB entry 5wc5

View 5wc5 on RCSB PDB site
Description: Structural insights into the potency of SK/IK channel positive modulators
Class: metal transport
Keywords: Calcium binding protein, METAL TRANSPORT
Deposited on 2017-06-29, released 2017-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Small conductance calcium-activated potassium channel protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2S1 (1-92)
      • expression tag (0)
      • engineered mutation (14)
      • expression tag (93-94)
  • Chain 'R':
    Compound: Calmodulin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Calm1, Calm, Cam, Cam1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DP23 (2-145)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5wc5r1, d5wc5r2
  • Heterogens: SO4, GOL, CA, AJV, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5wc5R (R:)
aalteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev
demireadidgdgqvnyeefvqmmta