PDB entry 5waw

View 5waw on RCSB PDB site
Description: FcAbVance: Increasing our knowledge of antibody structural space to enable faster and better decision-making in antibody drug discovery
Class: immune system
Keywords: fAb, AbVance project, Pistoia Alliance, IMMUNE SYSTEM
Deposited on 2017-06-27, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WAW (0-216)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WAW (0-End)
    Domains in SCOPe 2.07: d5wawl1, d5wawl2
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5wawL (L:)
    divmtqsplslpvtpgepasiscrvsqsllhsngytylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqtrhvpytfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wawL (L:)
    divmtqsplslpvtpgepasiscrvsqsllhsngytylhwylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqtrhvpytfgggtkveikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge