PDB entry 5wa9

View 5wa9 on RCSB PDB site
Description: Human Histidine Triad Nucleotide Binding Protein 1 (hHint1) H112N mutant nucleoside D-Ala phosphoramidate substrate complex
Class: hydrolase
Keywords: histidine triad, HYDROLASE
Deposited on 2017-06-26, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT, PKCI1, PRKCNH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49773 (Start-128)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5wa9a_
  • Chain 'B':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT, PKCI1, PRKCNH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49773 (Start-128)
      • engineered mutation (114)
    Domains in SCOPe 2.07: d5wa9b_
  • Heterogens: 9ZD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wa9A (A:)
    snamadeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipk
    khisqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlg
    grqmhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wa9A (A:)
    rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
    sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlggrqmhwppg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wa9B (B:)
    snamadeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipk
    khisqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlg
    grqmhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wa9B (B:)
    gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll
    ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlggrqmhwppg