PDB entry 5w8u

View 5w8u on RCSB PDB site
Description: Crystal structure of MERS-CoV papain-like protease in complex with the C-terminal domain of human ISG15
Class: signaling protein
Keywords: Signaling protein, Hydrolase, papain-like protease, ISG15
Deposited on 2017-06-22, released 2017-09-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ORF1ab protein
    Species: Human betacoronavirus 2c Jordan-N3/2012 [TaxId:1306931]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w8ua1, d5w8ua2
  • Chain 'B':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161 (1-77)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5w8ub_
  • Chain 'C':
    Compound: ORF1ab protein
    Species: Human betacoronavirus 2c Jordan-N3/2012 [TaxId:1306931]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w8uc1, d5w8uc2
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Homo sapiens [TaxId:9606]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05161 (1-77)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5w8ud_
  • Heterogens: ZN, AYE, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w8uA (A:)
    qltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnl
    tadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtl
    dllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelc
    csarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlveht
    tpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskt
    sdwkckvtdvlfpgqkyssdcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8uA (A:)
    ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
    adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
    llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
    sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
    pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
    dwkckvtdvlfpgqkyssd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w8uB (B:)
    meplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
    eyglkplstvfmnlrlrgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8uB (B:)
    meplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
    eyglkplstvfmnlrlrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w8uC (C:)
    qltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnl
    tadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtl
    dllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelc
    csarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlveht
    tpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskt
    sdwkckvtdvlfpgqkyssdcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8uC (C:)
    ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
    adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
    llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
    sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
    pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
    dwkckvtdvlfpgqkyssd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w8uD (D:)
    meplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
    eyglkplstvfmnlrlrgx
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8uD (D:)
    meplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplg
    eyglkplstvfmnlrlrg