PDB entry 5w83

View 5w83 on RCSB PDB site
Description: Rpn8/Rpn11 dimer complex
Class: hydrolase
Keywords: Protease, HYDROLASE
Deposited on 2017-06-21, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26s proteasome regulatory subunit rpn8
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: RPN8, YOR261C, O5360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w83a_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase RPN11
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: RPN11, MPR1, YFR004W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w83b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w83A (A:)
    mslqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeede
    knsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpll
    livdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdvrd
    qaagglsirltnqlkslkglqsklkdvveyldkvinkelpinhtilgklqdvfnllpnlg
    tpdddeidvenhdrinisnnlqkaltvktndelmviyisnlvrsiiafddlienkiqnkk
    iqeqrvkdkqskvsddsesesgdkeatapliqrknkkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w83A (A:)
    lqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedekn
    sdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpllli
    vdvkqqgvglptdayvaieqvdgtstektflhlpctieaeeaeeigvehllrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w83B (B:)
    merlqrlmmnskvgsadtgrddtketvyissiallkmlkhgragvpmevmglmlgefvdd
    ytvnvvdvfampqsgtgvsveavddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlss
    vdvntqksfeqlnsravavvvdpiqsvkgkvvidafrlidtgalinnleprqttsntgll
    nkaniqalihglnrhyyslnidyhktaketkmlmnlhkeqwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w83B (B:)
    ketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsavddvfqak
    mmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvdpiqsvkgk
    vvidafrlidhyyslnidyhktaketkmlmnlhkeqwq