PDB entry 5w5z

View 5w5z on RCSB PDB site
Description: Crystal structure of BAXP168G in complex with an activating antibody at high resolution
Class: apoptosis
Keywords: Fab, BAX activation, unfolding, APOPTOSIS
Deposited on 2017-06-16, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Gene: BAX, BCL2L4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (30)
      • engineered mutation (136)
  • Chain 'H':
    Compound: 3C10 Fab heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W5Z (0-End)
  • Chain 'L':
    Compound: 3C10 Fab light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W5Z (0-End)
    Domains in SCOPe 2.07: d5w5zl1, d5w5zl2
  • Heterogens: EDO, PG4, PGE, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5w5zL (L:)
    diqmtqspsflsasvgdrvtinckasqnvnkyldwyqqnlgeppklliyhtnslptgips
    rfsgsgsgtdftltisslqvedvatyfclqhdsgltfgsgtkleikradaaptvsifpps
    meqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqdskdstysmsstlsl
    tkveyerhnlytcevvhktssspvvksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w5zL (L:)
    diqmtqspsflsasvgdrvtinckasqnvnkyldwyqqnlgeppklliyhtnslptgips
    rfsgsgsgtdftltisslqvedvatyfclqhdsgltfgsgtkleikradaaptvsifpps
    meqltsggatvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqdskdstysmsstlsl
    tkveyerhnlytcevvhktssspvvksfnrne