PDB entry 5w4v

View 5w4v on RCSB PDB site
Description: Structure of RORgt bound to a tertiary alcohol
Class: nuclear protein
Keywords: RORgt Nuclear Hormone Receptor, NUCLEAR PROTEIN
Deposited on 2017-06-13, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (Start-209)
      • conflict (189)
    Domains in SCOPe 2.07: d5w4va_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (Start-209)
      • conflict (189)
    Domains in SCOPe 2.07: d5w4vb_
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (Start-209)
      • conflict (189)
    Domains in SCOPe 2.07: d5w4vc_
  • Chain 'D':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (0-End)
      • conflict (189)
    Domains in SCOPe 2.07: d5w4vd_
  • Chain 'E':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • conflict (189)
    Domains in SCOPe 2.07: d5w4ve_
  • Chain 'F':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • conflict (189)
    Domains in SCOPe 2.07: d5w4vf_
  • Heterogens: 9WA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w4vA (A:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklppkgklrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4vA (A:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlhkthrqsilaklppkgklrsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w4vB (B:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklppkgklrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4vB (B:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlhkthrqsilaklppkgklrsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w4vC (C:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklppkgklrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4vC (C:)
    iehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteaiq
    yvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelfr
    algcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlela
    fhhhlhkthrqsilaklppkgklrsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w4vD (D:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklppkgklrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4vD (D:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklpp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5w4vE (E:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklppkgklrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4vE (E:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlhkthrqsilaklppkgkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5w4vF (F:)
    slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
    eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
    elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
    lelafhhhlhkthrqsilaklppkgklrsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4vF (F:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlhkthrqsilaklpp