PDB entry 5w46

View 5w46 on RCSB PDB site
Description: Structure of S65D Phosphomimetic Ubiquitin Refined at 1.2 Angstroms Resolution
Class: signaling protein
Keywords: Ubiquitin, Phosphomimic, SIGNALING PROTEIN
Deposited on 2017-06-09, released 2017-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5w46a_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-75)
      • engineered mutation (64)
    Domains in SCOPe 2.06: d5w46b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w46A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkedtlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w46A (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkedtlhlvlrlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w46B (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkedtlhlvlrlrgg