PDB entry 5w41

View 5w41 on RCSB PDB site
Description: Zika MR766 NLS in complex with Importin alpha subunit-1
Class: viral protein/protein binding
Keywords: Zika, Nuclear Transport, Importin, Karyopherin, Virus, MR766, viral protein-protein binding complex
Deposited on 2017-06-08, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w41a_
  • Chain 'B':
    Compound: zika mr766 nls
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w41A (A:)
    mhhhhhhssglvprgsgmletaaalfernhmdspdlgtddddlamadigsnqgtvnwsve
    divkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcspiqfe
    sawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgsafrdl
    vikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilptlvrl
    lhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpalraign
    ivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglv
    pflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqv
    ildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliekyfsve
    eeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w41A (A:)
    gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
    dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
    dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
    ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
    palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
    qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
    kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
    iekyfs
    

  • Chain 'B':
    No sequence available.