PDB entry 5w3o

View 5w3o on RCSB PDB site
Description: CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, empty particle)
Class: virus like particle/immune system
Keywords: virus, antibody, VIRUS LIKE PARTICLE-IMMUNE SYSTEM complex
Deposited on 2017-06-08, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: EM
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral protein 1
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: viral protein 3
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w3ob_
  • Chain 'C':
    Compound: viral protein 2
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: C5 antibody variable heavy domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W3O (0-115)
    Domains in SCOPe 2.07: d5w3od_
  • Chain 'E':
    Compound: C5 antibody variable light domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W3O (0-106)
    Domains in SCOPe 2.07: d5w3oe_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w3oB (B:)
    glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
    kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
    alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
    ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w3oB (B:)
    ptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnnthtkd
    evnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgpal
    ssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvtsagflscwyq
    tslilppettgqvyllsfisacpdfklrlmkdtqt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w3oD (D:)
    avqlaesgpalvapsqalsitctvagfsltaygvawvrqppgaglewlgaiwaagatdyn
    aalksrasiakdnsksqvflamaslatadtaayycarewdaygdywgqgttvtvsa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w3oE (E:)
    divltqspaalsaaagatvaatcrasgnihnalawyqqkagkspqllvyaaaalaagvps
    rfsgsgsgtayalainslaaddfgayycqhfwstpytfgggtkleik