PDB entry 5w2p

View 5w2p on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis KasA in complex with 6U5
Class: transferase
Keywords: beta ketoacyl synthase I, lipid synthesis, fatty acid biosynthesis, transferase
Deposited on 2017-06-06, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) [TaxId:652616]
    Gene: kasA, ERDMAN_2470
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w2pa1, d5w2pa2
  • Heterogens: 6U5, GOL, NA, IPA, TCE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w2pA (A:)
    mgsshhhhhhssglvprgshmasvsqpstanggfpsvvvtavtattsispdiestwkgll
    agesgihaledefvtkwdlavkigghlkdpvdshmgrldmrrmsyvqrmgkllggqlwes
    agspevdpdrfavvvgtglggaerivesydlmnaggprkvsplavqmimpngaaaviglq
    lgaragvmtpvsacssgseaiahawrqivmgdadvavcggvegpiealpiaafsmmrams
    trndeperasrpfdkdrdgfvfgeagalmlieteehakargakplarllgagitsdafhm
    vapaadgvragramtrslelaglspadidhvnahgtatpigdaaeanairvagcdqaavy
    apksalghsigavgalesvltvltlrdgvipptlnyetpdpeidldvvageprygdyrya
    vnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w2pA (A:)
    qpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkigg
    hlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaeri
    vesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiahaw
    rqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfgea
    galmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelaglsp
    adidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvltl
    rdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry