PDB entry 5w1u

View 5w1u on RCSB PDB site
Description: Culex quinquefasciatus carboxylesterase B2
Class: hydrolase
Keywords: Carboxylesterase, alpha/beta hydrolase, HYDROLASE
Deposited on 2017-06-04, released 2017-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylic ester hydrolase
    Species: Culex quinquefasciatus [TaxId:7176]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w1ua_
  • Chain 'B':
    Compound: Carboxylic ester hydrolase
    Species: Culex quinquefasciatus [TaxId:7176]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w1ub_
  • Heterogens: EPE, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w1uA (A:)
    mslesltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetld
    csqqcepcyhfdrrlqkivgcedslkinvfakeinpskplpvmlyiygggftegtsgtel
    ygpdflvqkdivlvsfnyrigalgflccqseqdgvpgnaglkdqnlairwvleniaafgg
    dpkrvtlvghsagaasvqyhlisdaskdlfqraivmsgstynswsltrqrnwveklakai
    gwdgqggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmipk
    epfemartawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekr
    iefaaklkqryypdsspsmennlgyvhmmsdrvfwhglhrtilaraarsrartfvyricl
    dsefynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvi
    ngdpncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1uA (A:)
    sltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetldcsqq
    cepcyhfdrrlqkivgcedslkinvfakeinpskplpvmlyiygggftegtsgtelygpd
    flvqkdivlvsfnyrigalgflccqseqdgvpgnaglkdqnlairwvleniaafggdpkr
    vtlvghsagaasvqyhlisdaskdlfqraivmsgstynswsltrqrnwveklakaigwdg
    qggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmipkepfe
    martawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekriefa
    aklkqryypdsspsmennlgyvhmmsdrvfwhglhrtilaraarsrartfvyricldsef
    ynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvingdp
    ncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w1uB (B:)
    mslesltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetld
    csqqcepcyhfdrrlqkivgcedslkinvfakeinpskplpvmlyiygggftegtsgtel
    ygpdflvqkdivlvsfnyrigalgflccqseqdgvpgnaglkdqnlairwvleniaafgg
    dpkrvtlvghsagaasvqyhlisdaskdlfqraivmsgstynswsltrqrnwveklakai
    gwdgqggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmipk
    epfemartawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekr
    iefaaklkqryypdsspsmennlgyvhmmsdrvfwhglhrtilaraarsrartfvyricl
    dsefynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvi
    ngdpncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1uB (B:)
    esltvqtkygpvrgkrsvsllgqeyvsfqgipyarapegelrfkapvppqnwtetldcsq
    qcepcyhfdrrlqkivgcedslkinvfakeinpskplpvmlyiygggftegtsgtelygp
    dflvqkdivlvsfnyrigalgflccqseqdgvpgnaglkdqnlairwvleniaafggdpk
    rvtlvghsagaasvqyhlisdaskdlfqraivmsgstynswsltrqrnwveklakaigwd
    gqggesgalrflkaakpedivanqeklltdqdmqddiftpfgptvepylteqcmipkepf
    emartawgdkidimiggtseegllllqkiklqpellshphlflgnvppnlkismekrief
    aaklkqryypdsspsmennlgyvhmmsdrvfwhglhrtilaraarsrartfvyricldse
    fynhyrimmidpklrgtahadelsylfsnftqqvpgketfeyrglqtlvdvftafvingd
    pncgmtaksgvvfepnaqtkptfkclniandgvafvdypdadrldmwdamyvndelf